<!-- --><!-- --><style type="text/css">@import url(http://beta.blogger.com/css/navbar/classic.css); div.b-mobile {display:none;} </style> <meta name='google-adsense-platform-account' content='ca-host-pub-1556223355139109'/> <meta name='google-adsense-platform-domain' content='blogspot.com'/> <!-- --><style type="text/css">@import url(https://www.blogger.com/static/v1/v-css/navbar/3334278262-classic.css); div.b-mobile {display:none;} </style> </head><body><script type="text/javascript"> function setAttributeOnload(object, attribute, val) { if(window.addEventListener) { window.addEventListener('load', function(){ object[attribute] = val; }, false); } else { window.attachEvent('onload', function(){ object[attribute] = val; }); } } </script> <div id="navbar-iframe-container"></div> <script type="text/javascript" src="https://apis.google.com/js/platform.js"></script> <script type="text/javascript"> gapi.load("gapi.iframes:gapi.iframes.style.bubble", function() { if (gapi.iframes && gapi.iframes.getContext) { gapi.iframes.getContext().openChild({ url: 'https://www.blogger.com/navbar.g?targetBlogID\x3d4933267722180946626\x26blogName\x3dYou+and+Me.\x26publishMode\x3dPUBLISH_MODE_BLOGSPOT\x26navbarType\x3dTAN\x26layoutType\x3dCLASSIC\x26searchRoot\x3dhttps://breathe-with-us.blogspot.com/search\x26blogLocale\x3den\x26v\x3d2\x26homepageUrl\x3dhttp://breathe-with-us.blogspot.com/\x26vt\x3d-6976742631093283887', where: document.getElementById("navbar-iframe-container"), id: "navbar-iframe", messageHandlersFilter: gapi.iframes.CROSS_ORIGIN_IFRAMES_FILTER, messageHandlers: { 'blogger-ping': function() {} } }); } }); </script> <iframe src="http://beta.blogger.com/navbar.g?blogID=36048451" height="30px" width="100%" marginwidth="0" marginheight="0" scrolling="no" id="navbar-iframe" frameborder="0"></iframe> <div id="space-for-ie"></div>
Thursday, April 30, 2009

yawyawyaw !

ctee here ..
hahahah .
okayyokayy , since been along time tarq post dekat blog nie .
sorry ehh , harap dimaafkan .

LOL !
kayy , manymanymany thingy happen .
which is i cant remember what it is .
LOL ? -_=

exam coming or myb MID-YEAR coming ?
haha . what the diff anyway ?
okayy , so havent been study-ing hard .
hahahaha ( still dare too laugh ) 

" hutang " mr lim SCIENCE hmwk !
bnykk horr ! it's like 3 chapter & lagy past year paper . klao satu tarq pehh jugakk , but it's like 13 or 14 gytu .
haiyahh !
HOW TO FAILED SCIENCE ! hahahaha .

- get to spent time with my ONE & ONLY NAAZIYA BEGUM BINTE SHAIK MD ALI .
yeahhyeahhyeahh .

to my ONE & ONLY BESTIE :
ppd low , sorry ehh bestie !
ifcukingmissyouluhhbeylo . bile narq turon cck lagy ? ajakk KAKAK NIKI skaly ye .
bdw , angkong siao nmpk ? LOL ! nile narq biken yg betol nyer ?

Labels: ,


Blogged @ 5:16 PM
Don't let me go -

Tuesday, April 28, 2009

Weird dude..

Heres the thing, Yesterday when i met my fiance, she showed me this weird looking dude with partly red lips for some reason. This guy in the video was supposingly going to threaten Aisha(Fakhitah's friend) and Fakhitah herself !! 
Well, Let me tell you old dawg .. You aren't going to threaten someone to do something they dn't like and act as if you're in control of the situation.
You know what old man who looks like stingray, MY MUM IS A POLICEWOMEN AND SHE HAS THE RIGHT TO ARREST YOU.. Act tough again !!. the next thing you knew. The moment you step into singapore. Dn't ever wish to get out of the checkpoint. Muahahahahahaha.
Oh, So wat if you get thru Singapore?. You old man may ask.. Come closer to my fiance and her friend, you're going to see me unleash into a beast !!. SATAN, DAJJAL. whatever you want to call it. I'll be that if you dare come to Singapore and threaten those girls.

In the video, The old man i was reffering to was like.. 
" Mama, Papa tahu selama ni papa banyak buat salah. Tapi kini papa sedar dan papa akan ambil nasihat mama, Papa mahu berubah blablabalabalabalbalab"
Uhh yerlarhh !!.. Berubah !!.. Berubah longgar seluar arh beb !!!!!!!!!!!!

Oh, I just wish that immatured old bones would read this post.!!

(Laii arhh. Kau berani jejak singapore nak ganggu org yang aku sayang, skrg nie aku tak suker kalau sesiaper aku kenal tak hidup dengan damai, walau sesiaper pun. Kau nak cuba bawak tunang aku dgn kawan dier pergi hotel?. EHk CAUCIBAI lllaa !!.. Langkah mayat aku dulu!!. Kalau aku dapat info yang kau da sampai. Siap kau Buto !!. Aku carik kau ker lobang cacing, Da conferm itu kau jgn harap nak HIDUP !!. nak mengucap pun tk sempat sebab kalau kawan dan tunang aku kener ngancam !!. Aku tak ingat tuhan, Aku cumer ingat yang aku lindungkan org yang aku sayangi. Jadi sekarang kau fikir ader due perempuan jerr?.. Mehh sini, Datang singapore. check check Lelaki pun nak maen jubo karat kau tularhh !!. Kau tgk jerr laki sundal. Kalau Aisha atau Fakhitah bilang aku pasal kau buat pehel lagyy. Pfft, Siang malam aku sumpah tak tidur siol !!. Jadie kalau kau berani, Datang)

Oh, And Aisha. You can send that bracket part to that guy with no face. Reminds me of a stingray when i look at his face. mama papa konon. Ehkk !!. Melutut depan mak kau laa Jantan !!. when you send it to him, Tell him it was from me. 

THANK YOU..

Blogged @ 8:42 AM
Don't let me go -

Sunday, April 26, 2009

WARNING
the tattoos you are about to see are merely ONE of Muzka's
Creation, It has no intention to relate with the living and the dead.
Muzka is not responsible for any imitations from the tattoo shop you
see, If any of the tattoos seems similar.
It is TOTALLY coincidence.
THANK YOU.


Tattoos of a tribal thorn and vines on my right shoulder and arm.

Muzka on my chest and tribal fire on my left shoulder.

Overview of the whole tattoos. Muzka on the chest, DGK on my ribcage and the tribal fire.

Blogged @ 6:08 PM
Don't let me go -



Blogged @ 6:08 PM
Don't let me go -


2 days from friday to saturday... What did i do?

Friday- Go to school as per normal, First class starts at 8 but i came at 8:55. So the class ended at 9:30, Went down to the canteen and had my breakfast. Ate alone since most of my friends didn't come. So i dn't give a shit.
After Math class i remember i had electronics theory class. Came late as well becuz i chit chat with my Student Councillor senior..
 The lesson was normal, Sms my fiance during the class. then after that did sme assignments and went off downstairs to have PE. Sat in the canteen again. Didn't wanna attend the PE as it was darn boring but i ended up stripping my uniform and play
ed soccer in the HOT SIZZLING FIELD !!..
 After dat we as one class were all sweating like pigs. I then rush out of my campus and took bus 178 with Khai.
Went home, Got ready to go for Tanglin School again.. IT was a hot day but i try to look at my best. dn't believe me. Ask Fakhitah how i look on friday. She saw me. So i ZOOMMM like hell to Redhill, quickly finishes up the seminar thingy and zoom back to WOODLANDS.. what did i do there?. Well, I bought chocolate waffle and oreo crush for my fiance and fetch her from school.. 
 Waited for her in Republic Polytechnic.. Waited for her 
in her campus till she arrives, I knew she didn't had her lunch, So atleast i could get her something straight away. Aren't i sweet or what ?.. WAKAKAKAKAKA.
She was shocked that in the ferst place i was IN her school with my ITE uniform, Becuz she thought that i wuld feel intimidated by all the poly students. but let me tell you guys something.
My love for her is so strong that it overcomes my intimated feelings.

Yerp.. Thats true. So after that we both walked and went to Vivo City !!. I remembered we shared a bowl of this huge bowl of noodle but i forgot what its called. Then she drank tea and plain water while i had gassy drinks to sooth my mout
h. We watched the nightfall at the sky garden and had a romantic time together. It was windy and cold, The breeze is just perfect for you. Fuhhlamakk.. come to think of it again. BEST seyhh nighttime !!



Saturday- Saturday morning was boring,. I did my house chores,Ate, Slept, Watch teevee and do house things laa while Fakhitah went out with her two other friends looking for jobs. Well. until 7 . I bath. hehehe, then got ready to go out with my family for this reunion with ym cuzins yyaww.. So we went down there, Played games in the car and reached the destinations i disturbed some of the old folks there becuz for them. I am one of their favourites. So whatever i do would be funny in someway !!. Weird but its true. Left the place at around 10pm. The whole family suddenly got thirsty and decided to go for a drink at this hawker centre which i dn't know the name of the place. There, I ordered for a chocolate shake. But thats not all that we whole family got. My dad even got into an argument with the helper and shop owner due for some reasons which is too hard to tell here. you just need to call me up and ask what happened then i could elaborate it with full of sound effects.
 In the end, My whole family dn't even know whos at fault. haha.. But it was hawt, There was shouting going on,Punching,kicking, bottle clashing.. in the hawker centre !!!!..
Wanna know what happened.?.. You know who to call.. wakakakaa

Blogged @ 9:20 AM
Don't let me go -

Thursday, April 23, 2009

HAiyyaa.. where is my bluetooth device,the old one is spoilt and my mum still haven't bought a new one..

Atlast i have the time to blog. After all, the past few days or w
eeks i was busy with school student seminar,Student councillors and skateboarding stuffs.
right now im soo bored that im drawing tattoos all over my body. On
 my shoulder,Forearm,Chest and lots more.. haha, Dats wad i do
 wen im bored.

uhhh. student seminar which is on friday but i forgot which friday.. Last week ones??.. Well, didn't go to school. got ready and met amin at Jurong East interchange. took the train and alighted and Redhill station.
first thoughts when going to Tanglin School of Assoc
iation was.. "Is the students here crazy in some way??.. Are there hawt chix here???" .. haha, Anxious llaa !!
But then they turn out to be fine as ever, Funny as hell and spontaneous.. We acted out, Showed our talents, and just have fun introducing ourselves.. Then final
ly its time to go home.. !!.
 My fiance picked me up at redhill MRT and we walked to
 see her old blok there, After that we went to.... uurrmm, Wait wait i ask her. I forgot.
 KAEKAE !!.. NOw i remember !1.. I know how to get the pics here.. From my FIANCE !!!!!!!!!!.. WOw.. she so helpful !!!!!!!!!! kaekae.. Got the PICTURES already !!..
 I remember now.. We went to ESPLANADE and took some photos there..
Below are some of the examples ...


I dn't know what got into me but yar.. this is Muzka



Kaekae, I know this picture is ugly.. but oh well, Memories..

This one... Muzka the drinking model. (Remember, Green tea ice mint is the best).

kaee, Dats about it. The rest will be the next time i post... uurmmm, Next.. How bout my school stuffs. So Today i was just informed that there wil be a PRACTICAL TEST in the workshop. At ferst i was all worried and stuff but then when i reached there. OH MY GOODNESS !!!.. I just realise how important a teacher is. The lecturer didn't give me the answer, They just provide the board,tools and needed items like wires,fuse or switch and plug. and I noticed that while doing, I seem to know what im doing.. ITs like natural.. I almost cried mersmerizing the wonders of teaching. Its like from square one i drilled,cut,nailed,connect all the wires with different colours and sizes into the correct way from the live to the earth. It was just plain AWESOMe what a teacher culd do !!

Gawsh, ITs just amazing... kaellaa. Dats about it. I dn't know what else to post. But if theres anymore and a free time. I'll be definitly post alryte.. NOT like CTEE tuu..

WKAKAKAKKWMUZKAWKAKAKWKAKKWKAKWK
WAKAKWKAKAKWKAKAKWKAKANDWAKAKWAKAKKACTEE
BESTIEWAKKWKAKWKAKWKAKKWKAKFOR
WKAKAKWAKAKWKAKALIFEKWKAK...WAKAKWKAKK
WAKWAKWKAKWKAKWKAKWKAKWKAMUZKAKWWAKAKAKAKAKA
WKAALSOKWAKWKAKWKAKWKAKWKAKWKAKW
WAKLOVEAKWKAFAKHITAHWAKAKAKAKAKAKAKWWHATAMIDOING?????

Blogged @ 1:43 PM
Don't let me go -

Tuesday, April 14, 2009

Harloww everybody !!. Its Muzka here and im back with more interesting stories !!
 So today is Wednesday and i didn't go to school becuz of some specific reason. Not going to elaborate more but Muzka is OFFICIALLY afraid and has PHOBIA towards HENNA !!
 YES !!.. In the history of the day you all know it now. INFACT, Its becuz of HENNA that i felt weak resulting in staying at home.. UGHH !!. I dn't want to tell you guys what exactly happened but one thing for sure for me it was so DISTURBING, GROSS AND JUST PLAIN SICK .. That is from my view ONLY !!.. For you human heads out there, You guys are normal with it. Just understand me.. PHOBIA ..

 So lets start the schedule from Monday..

Monday- I remembered waking up at 6 and got ready for school, Wore my formal attire on this day. Must look good, So alryte. Took the train and reached school. Reported to the SC room and asked for a card from my senior to write down my script. So i did wrote down my script in a dash. It was 8am then, I wore my tie, Bring along my card and a pen then just march off to the auditorium. First impression of the EMCEES . Well groomed, Pretty and Handsome.
But then my senior, Maisarah did better than me and i talked abit startled and i accidentally RAP out the pledge.. haha, You knoe what i mean. Then finally END of the horrible and dissapointing act of the day !!. After that left my campus and went straight to my Fiance house and fetch her right infront of her doorstep. We look like a married couple.
the guy- folded long white sleeve,black pants and belt complete with a black formal shoe. Broad shoulder and calm looking face. 
the girl- black head scarf(tudung), Black with yellow pattern Baju kurung with black blouse. Medium body size,Fat butt but cute looking face.

See what i mean, Aren't we both adorable.. haha, I remembered we went to junction 8 . As per USUAL gerls when they see their frens, They will quickly leave her boyfriend hands and just dash out straight to her frens. STANDARD, USED TO IT.. I was smiling all the way becuz i knew i was right about gerls.. SOO all the girls out there DON'T EVER DENY ME WHEN I SAY I KNOW YOU WELL !!!.. Kaeem So they talked for awhile and i just stand still one corner. On second thought if i would have walked back she wouldn't even realize it !!.. haha.
then BLABLABLA then we both went home .. THE END.


Tuesday- This day i didn't need to wear formal, Just school uniform and the student councillor badge. But on this day i was the only ONE up on the stage as the EMCEES . OH Fcuk !!, Ferst tyme kann. furthermore i got a bad coughing problem and my flu sn't any better. So i keep on sucking my flu and coughs roughly. So when i talk on the mic, I would be like.
"Now i would like shhrrtt to invite sshhrtt Mr Wah shhrtt Tee Chew ..to give us shhrtt a talk about shhrtt the campus shhrtt rules and regulations. shhrtt, Mr wah plz.."

Thats how bad i did for tuesday.. So at the end of the day there is a debrief. BLABLABLA and went home straight to rest and sleep !!.. THE END..

Blogged @ 9:36 PM
Don't let me go -

Saturday, April 11, 2009

so yeahh ,
finally got time to post .
let me start with last

MONDAY :

as usual ade time prac after schl .
so yeahh , ade halfandhour break . go outside schl , walkwalkwalk , go straight too one block and started to smoke , dhen dha lmbt , balekk schl , cikgu dha start dyer nyer time prac , dhen she told me that i must wait , sebab lmbt . dhen i must wait , dhen dha abes time prac , i pass up the paper , she smell something . she asked i got smoke ahh ? dhen i matymaty nonononononono . dhen she started to find some clues . she got take my lighter !! fcukkshit ! dhen she search my beg hoping too find cigg , but too bad ! i dont have one ! wohoooooooooo ! LOSERFCUKFACE !
dhen she asked me too follow her to go to the office & all that stuff , then she say , i give euu one chance if euu be honest with her , so , yeahh , i tell her that i smoke all that stuff . so yahh , lepas tuu , tarq narq balekk , but naaziya force me too go hme sume , so yeahh , send her hme , dhen waste my time , as i seriously dontwant too go hme early . dha smp rumahh , my mum asked me why i didnt pick up her korl , i say ppd low . she told me my form teacher baru je korl , say i blahhblahhblahh nie sume . so yeahh , starting from TUESDAY , he will sent me hme ! EVERY FCUKING DAY !
woahhhhhhhhhh ! it like an officer sent me bck hme sakkk ! basically , my parents & most of the teacher are dissapointed in me & did not trust me anymore , so i cannot go out from this hse anymore unless i am going to schl & my FREEDOM kene amekk !!!

THURSDAY :

last thursday ade e-learning .
so yeahh , as per normal , stay at hme do all the work that our teacher's had asked ur too do .
ferst period is CPA , as usual , gye website dyer , buat CPA nie sume . dha abes buat kene print . dhen i realise that my printer tarq working . alamakk ! kepale bahalo nyer printer , that what i say uhh . hahaha .
dhen i go play game , chatchatchatchat sume uhh dhen ade satu part nie , i wait for all my classmates to online , bile almost my classmates dha online , iinvite them too one conversation which contains all 4C 2009 ! wohoooooooooo ! they all crazy & all that kind of stuff uhh . but the best thingy is , they dontknow who invite them . hahahah .
so we all chatchat , exchange answer sume uhh .
hahaha .
dhen one-by-one get irritated and left the conver , including me . hahaha .
chat with " someone " until " schl " end . ahahahha .
in short , i didnt do my e-learning , corz my comp shut down half way ! wtfcukk sia !

FRIDAY :

friday tarq schl . dudokk rumahh je . but !! naseb my dad narq kluar gye hospital visit my adeq sedare . kesian dyer !! seblom kluar , get to korl " someone " , talktalktalktalk & dhen kene siap , so lepas tuu , siap , gye hospital , dhen , hantar my abg lepakk dekat woodlands , dhen gye my uncle hse , take something , dhen go m'sia , visit my nenek & atok yg tinggal dekat sane , slackkslackk dere , take picture sume . suppose to sleep there , but later i miss someone , so change my mind . =)
dhen balekk s'pore , take my abg , go buy food , dhen went hme .
dha balekk , on tv tengok cite hantu , dhen someone ajakk me lepakk , so yeahh , i agree , dhen klaur rumahh , lepakklepakk , do something yg against the law , dhen balekk .

SATURDAY :

currently do nothing , chatting my one & only NAAZIYA .
SORRY GUYS , I IGNORE EUU ALL .
hopefully my dad will be bck hme soon !!
it like hell sia at hme , w/o kluar runahh sume .
haiyooh !
nevermind naaziya , lagy satu hari je ` so yeahh , try too bear with it ehh !

Labels:


Blogged @ 4:15 PM
Don't let me go -

Monday, April 6, 2009

Saturday- Saturday was my 4th month anniversary which I planned to go out with my fiance but was then CANCELLED LAST minute due to certain circumstances. Its like the cancellation took a few hours before. So at ferst i was dissapointed but then i joined T.J.S.B to skate. So yeaa, Met at Taman Jurong and took bus 30 to Jurong point to meet Omar and Amirul. Then from boon lay we took the MRT all the way to bedok .. Tired and my butt cramped. gawshh.. But finally reached bedok we took a bus to East Coast Park . Alighted the bus and skated our way along the road. Gawsh it wass soo tiring. Its really far furthermore we skated the wrong direction.
wahaha. before reaching out destination we stopped at the foodcourt for a quick drink before departing again.. So then we reached our destination, Its halway built but it was pretty good to skate. Its the new INTERNATIONAL level skatepark at east coast . At ferst there was no way n as it was blocked by metal barriers becuz workers are still werking but we came around and found the main entrance. Firstly the foreign worker there scolded us for going beyond the boundaries but then we negotiate. We only wanted to see the park. So yeaa, We put out decks outside so we were able to go in. The BOSS became friendly with us and tour the whole place to us. ( I got the pictures of the skatepark but my bluetooth devise kaesiao) .. then suddenly theres this HUGE deep bowl its like 2 stories deep. So the BOSS dares us to slide down there and climb back out, If we were able to do it then we could skate here. So we were all syiok to the limit so we did the dare. It was pretty damn hard but we manage to climb ourselves out. IT was soo wicked, We brought our decks in and skated our heart out, We skated in another awesome bowl and the whole skateparks except for the deepshit bowl we just climb out of.
I got a few pictures and video of the skateparks and us skating in the skatepark. Soo yeaa, I will upload it as soon as my USB is okaee..



Sunday- Met at Taman Jurong CC at 12:30pm, there were Muzka, Harizcine and Ravespanner(RAfiq) . So we chatted with the CC board members and then the bus arrives so we boarded the bus and the bus brought us to Bukit Batok CSC .. where we had brainstorming session,games and events. At 6pm was my favourite part. We get to eat our heart out siaa !!!.. They served us dishes one by one, there was popiah,fruits and fries,Then ikan bakar, Then Soft tender huge chicken then Huge scrumptous prawns next was this sharfin soup complete with big mushrooms with soups..  And the drinks, Your choice, They will refill it everytime ur drink reacher half of the glass.. muahahah.
And we also get to shake Mr Tharman hands and talked to him about the skatepark and our skateboarding matters. then Mr tharman told us that he will upgrade the skatepark seyhh !!!.. Nice one !!!!!. every one of the board members welcome us as newcomers of youth to sports in Skateboarding category. ohh yeaa.. then karaoke session i sang gadis melayu. wakaka.
SIAPA BILANG GADIS MELAYU TAK MENAWAN,TAK MENARIK HATI.
wakakakakaka... Theres alot of funny moments during the karaoke session. Its too much that im getting tired typing. Just call me up to know.


Monday-Woke up at 8, got ready and left home at 8:50am.. Reached skul 9:17am and we had April Orientation Intake 2009 REHEARSAL .. And guess wad guys.. I got appointed as the 
EMCEES .. Woots !!.. Check out Muzka !!. EmCees dookk... talk talk talk. Script and all that laa.. ALLAA !! I actually want to be the PA but they say can't. Give others the chance !!. So Emcees, Emcees llaa
. I'll be wearing formal but now with a blazer yaww !!..

Blogged @ 3:55 PM
Don't let me go -

Friday, April 3, 2009

My mum, Brother and me
..When we get bored we just snap
pictures of ourselves and just laugh about it 
like a few hours ago.
This is the result..
Muzka,Yanie and Faiz smiles with alot of fakeness.. Its like we're saying " Just get this over please".


We as family says that we all agree to NO to evil,hear NOTHING about evil and see NO evil.



Alryte, Skip about the family part. Tommorow is 4th of April and you all know what day is it. Haha, Yess !!. Its my FOURTH MONTHS ANNIVERSARY WITH FAKHITAH !! hAPPY?.. Happy sangat2 .
Well,For the ferst month she gave me a pair of earpiece and belt,So i gave her a keychain with my name on it. Then our second month i forgot what but i think i gave her a necklace with my initials on it. Well for the third month we both didn't give anything to each other but had a GREAT tyme spending tyme together. It was AWESOME !!!!!!!!!!!.
So for the ferst month im going to ask her out to i dn't know where but i made for her a homemade envelope and a bracelet complete with a letter in it. ermm, The content of the letter i haven't made it yet. Im going to write it later when im listening to MJ12 . Soo yeaa. I just hope dat she likes what ive done for her since the last four months !!.

Well you see, ITs not all about giving gifts. Gifts are just iniciatives that you want to do it or not,If you dn't want it then its TOTALLY fine becuz the most important is the thought that comes ferst, The sincerity is IMPORTANT. LOVE must be given every single day and each individuals MUST be serious in their relationships !!.

I wish all couples happy advance and belated anniversary !!. Hope dat you both will last long, Who ever you are !!!..


Blogged @ 9:48 PM
Don't let me go -