<!-- --><!-- --><style type="text/css">@import url(http://beta.blogger.com/css/navbar/classic.css); div.b-mobile {display:none;} </style> <meta name='google-adsense-platform-account' content='ca-host-pub-1556223355139109'/> <meta name='google-adsense-platform-domain' content='blogspot.com'/> <!-- --><style type="text/css">@import url(https://www.blogger.com/static/v1/v-css/navbar/3334278262-classic.css); div.b-mobile {display:none;} </style> </head><body><script type="text/javascript"> function setAttributeOnload(object, attribute, val) { if(window.addEventListener) { window.addEventListener('load', function(){ object[attribute] = val; }, false); } else { window.attachEvent('onload', function(){ object[attribute] = val; }); } } </script> <div id="navbar-iframe-container"></div> <script type="text/javascript" src="https://apis.google.com/js/platform.js"></script> <script type="text/javascript"> gapi.load("gapi.iframes:gapi.iframes.style.bubble", function() { if (gapi.iframes && gapi.iframes.getContext) { gapi.iframes.getContext().openChild({ url: 'https://www.blogger.com/navbar/4933267722180946626?origin\x3dhttp://breathe-with-us.blogspot.com', where: document.getElementById("navbar-iframe-container"), id: "navbar-iframe" }); } }); </script> <iframe src="http://beta.blogger.com/navbar.g?blogID=36048451" height="30px" width="100%" marginwidth="0" marginheight="0" scrolling="no" id="navbar-iframe" frameborder="0"></iframe> <div id="space-for-ie"></div>
Thursday, April 23, 2009

HAiyyaa.. where is my bluetooth device,the old one is spoilt and my mum still haven't bought a new one..

Atlast i have the time to blog. After all, the past few days or w
eeks i was busy with school student seminar,Student councillors and skateboarding stuffs.
right now im soo bored that im drawing tattoos all over my body. On
 my shoulder,Forearm,Chest and lots more.. haha, Dats wad i do
 wen im bored.

uhhh. student seminar which is on friday but i forgot which friday.. Last week ones??.. Well, didn't go to school. got ready and met amin at Jurong East interchange. took the train and alighted and Redhill station.
first thoughts when going to Tanglin School of Assoc
iation was.. "Is the students here crazy in some way??.. Are there hawt chix here???" .. haha, Anxious llaa !!
But then they turn out to be fine as ever, Funny as hell and spontaneous.. We acted out, Showed our talents, and just have fun introducing ourselves.. Then final
ly its time to go home.. !!.
 My fiance picked me up at redhill MRT and we walked to
 see her old blok there, After that we went to.... uurrmm, Wait wait i ask her. I forgot.
 KAEKAE !!.. NOw i remember !1.. I know how to get the pics here.. From my FIANCE !!!!!!!!!!.. WOw.. she so helpful !!!!!!!!!! kaekae.. Got the PICTURES already !!..
 I remember now.. We went to ESPLANADE and took some photos there..
Below are some of the examples ...


I dn't know what got into me but yar.. this is Muzka



Kaekae, I know this picture is ugly.. but oh well, Memories..

This one... Muzka the drinking model. (Remember, Green tea ice mint is the best).

kaee, Dats about it. The rest will be the next time i post... uurmmm, Next.. How bout my school stuffs. So Today i was just informed that there wil be a PRACTICAL TEST in the workshop. At ferst i was all worried and stuff but then when i reached there. OH MY GOODNESS !!!.. I just realise how important a teacher is. The lecturer didn't give me the answer, They just provide the board,tools and needed items like wires,fuse or switch and plug. and I noticed that while doing, I seem to know what im doing.. ITs like natural.. I almost cried mersmerizing the wonders of teaching. Its like from square one i drilled,cut,nailed,connect all the wires with different colours and sizes into the correct way from the live to the earth. It was just plain AWESOMe what a teacher culd do !!

Gawsh, ITs just amazing... kaellaa. Dats about it. I dn't know what else to post. But if theres anymore and a free time. I'll be definitly post alryte.. NOT like CTEE tuu..

WKAKAKAKKWMUZKAWKAKAKWKAKKWKAKWK
WAKAKWKAKAKWKAKAKWKAKANDWAKAKWAKAKKACTEE
BESTIEWAKKWKAKWKAKWKAKKWKAKFOR
WKAKAKWAKAKWKAKALIFEKWKAK...WAKAKWKAKK
WAKWAKWKAKWKAKWKAKWKAKWKAMUZKAKWWAKAKAKAKAKA
WKAALSOKWAKWKAKWKAKWKAKWKAKWKAKW
WAKLOVEAKWKAFAKHITAHWAKAKAKAKAKAKAKWWHATAMIDOING?????

Blogged @ 1:43 PM
Don't let me go -